Dermatopontin/DPT Protein, Human (HEK293, Fc, His)

Dermatopontin/DPT Protein facilitates adhesion by binding to integrins on the cell surface. It acts as a conduit for communication between dermal fibroblast cells and the extracellular matrix. Furthermore, it enhances TGFB1 activity, inhibits cell proliferation, promotes collagen fibril formation, and stabilizes them at low temperatures. DPT Protein interacts with TGFB1, DCN, and collagen. Dermatopontin/DPT Protein, Human (HEK293, Fc, His) is the recombinant human-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of Dermatopontin/DPT Protein, Human (HEK293, Fc, His) is 183 a.a., with molecular weight of 50-60 kDa.

The Dermatopontin/DPT protein is believed to facilitate adhesion through its binding to integrins on the cell surface. It may act as a conduit for communication between dermal fibroblast cells and their surrounding extracellular matrix. Additionally, it enhances the activity of TGFB1, inhibits cell proliferation, promotes the formation of collagen fibrils, and helps stabilize them against dissociation at low temperatures. The protein interacts with TGFB1, DCN, and collagen.

Human

HEK293

C-hFc;C-6*His

Q07507 (Q19-V201)

1805  [NCBI]

QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

50-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 4% Sucrose, 4% mannitol, 0.02% Tween80, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.