1. Recombinant Proteins
  2. Others
  3. Desmin/DES Protein, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag. The total length of Desmin/DES Protein, Human (His) is 210 a.a., with molecular weight of ~29.72 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag. The total length of Desmin/DES Protein, Human (His) is 210 a.a., with molecular weight of ~29.72 kDa.

Background

Desmin, a muscle-specific type III intermediate filament, is indispensable for maintaining the structural integrity and optimal function of muscles. It plays a crucial role in forming myofibrils and interconnecting Z-disks, providing strength to muscle fibers during activity. In adult striated muscle, Desmin contributes to the fibrous network that links myofibrils to each other and to the plasma membrane at the periphery of Z-line structures. Additionally, Desmin may serve as a sarcomeric microtubule-anchoring protein by associating with detyrosinated tubulin-alpha chains, resulting in buckled microtubules and increased mechanical resistance to contraction. Beyond its structural functions, Desmin participates in the transcriptional regulation of the NKX2-5 gene during cardiomyogenesis and in cardiac side population stem cells. Moreover, it plays a role in maintaining the optimal conformation of nebulette on heart muscle sarcomeres, facilitating the binding and recruitment of cardiac alpha-actin. Desmin engages in various interactions with proteins such as DST, MTM1, EPPK1, CRYAB, NEB, NEBL, ASB2, PLEC, and PKP1, highlighting its multifaceted involvement in molecular networks essential for muscle physiology.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P17661 (V261-L470)

Gene ID
Molecular Construction
N-term
6*His
Desmin (V261-L470)
Accession # P17661
C-term
Synonyms
rHuDesmin/DES, His; Desmin; DES
AA Sequence

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Weight

Approximately 29.72 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Desmin/DES Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Desmin/DES Protein, Human (His)
Cat. No.:
HY-P70006
Quantity:
MCE Japan Authorized Agent: