DKK-1 Protein, Human (HEK293, N-His)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293, N-His) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with N-8*His labeled tag.

DKK1 protein functions as a potent antagonist of canonical Wnt signaling through multiple mechanisms. It inhibits the interaction between LRP5/6 and Wnt and forms a ternary complex with the transmembrane protein KREMEN, facilitating the internalization of LRP5/6. Notably, DKK1 not only antagonizes the pro-apoptotic function of KREMEN1 in a Wnt-independent manner but also exhibits anti-apoptotic activity. The protein is implicated in limb development, where it modulates Wnt signaling to ensure normal limb patterning. Through its C-terminal Cys-rich domain, DKK1 interacts with LRP5 and LRP6, specifically engaging with beta-propeller regions 3 and 4 of LRP5. This interaction is further influenced by MESD and/or KREMEN, collectively leading to the attenuation of Wnt-mediated signaling. Additionally, DKK1 forms a ternary complex with LRP6 and KREM1, highlighting its multifaceted role in regulating crucial cellular processes and interactions with key proteins involved in Wnt signaling.

Human

HEK293

N-8*His

O94907 (T32-H266)

22943  [NCBI]

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

42-47 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.