1. Recombinant Proteins
  2. Others
  3. DMBT1 Protein, Human (HEK293, His)

The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag. The total length of DMBT1 Protein, Human (HEK293, His) is 201 a.a., with molecular weight of 35-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag. The total length of DMBT1 Protein, Human (HEK293, His) is 201 a.a., with molecular weight of 35-45 kDa.

Background

DMBT1 Protein emerges as a multifaceted candidate with potential tumor suppressor roles in brain, lung, esophageal, gastric, and colorectal cancers. Beyond its implications in cancer, DMBT1 is implicated in diverse biological processes, serving roles in the mucosal defense system, cellular immune defense, and epithelial differentiation. It acts as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including the gastrointestinal tract's epithelial cells. Furthermore, DMBT1 plays a role in liver regeneration and is a critical factor in the fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. Its involvement in the terminal differentiation of columnar epithelial cells during early embryogenesis is noteworthy. Additionally, DMBT1 functions as a binding protein in saliva, potentially regulating taste sensation. It binds to the HIV-1 envelope protein, displaying a dual role in both inhibiting and facilitating viral transmission. The protein exhibits a broad calcium-dependent binding spectrum against Gram-positive and Gram-negative bacteria, suggesting a significant role in defense against bacterial pathogens. DMBT1's diverse interactions, including association with the actin cytoskeleton and involvement in its remodeling during regulated exocytosis, highlight its versatile functions in cellular processes. Its pH-dependent interaction with pancreatic zymogens suggests a potential role as a Golgi cargo receptor in the regulated secretory pathway of pancreatic acinar cells, further underlining the complexity and importance of DMBT1 in various physiological contexts.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized recombinant human Galectin-3 at 10 μg/mL (100 μl/well) can bind biotinylated DMBT1-His with a linear range of 0.06-1.0 μg/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9UGM3/NP_004397.2 (T20-S220)

Gene ID
Molecular Construction
N-term
DMBT1 (T20-S220)
Accession # Q9UGM3/NP_004397.2
His
C-term
Synonyms
Deleted in malignant brain tumors 1 protein; Glycoprotein 340; Gp-340; Hensin; SAG; DMBT1
AA Sequence

TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRIS

Molecular Weight

35-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DMBT1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DMBT1 Protein, Human (HEK293, His)
Cat. No.:
HY-P75710
Quantity:
MCE Japan Authorized Agent: