1. Recombinant Proteins
  2. Others
  3. DNA-binding protein HU-alpha Protein, E.coli (His-SUMO)

DNA-binding protein HU-alpha Protein, E.coli (His-SUMO)

Cat. No.: HY-P71497
SDS COA Handling Instructions Technical Support

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, wraps DNA, offering stabilization and preventing denaturation in challenging conditions. Comprising alpha and beta chains in a heterodimer, it demonstrates versatile DNA binding and protective functions. DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) is the recombinant E. coli-derived DNA-binding protein HU-alpha protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, wraps DNA, offering stabilization and preventing denaturation in challenging conditions. Comprising alpha and beta chains in a heterodimer, it demonstrates versatile DNA binding and protective functions. DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) is the recombinant E. coli-derived DNA-binding protein HU-alpha protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, exhibits the capacity to wrap DNA, providing stabilization and preventing denaturation under challenging environmental conditions. It forms a heterodimer consisting of an alpha and a beta chain, contributing to its functional versatility in DNA binding and protection.

Species

E.coli

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P0ACF2 (M1-K90)

Gene ID

914933  [NCBI]

Molecular Construction
N-term
6*His-SUMO
hupA (M1-K90)
Accession # P0ACF2
C-term
Synonyms
hupA; Z5576; ECs4923DNA-binding protein HU-alpha; HU-2; NS2
AA Sequence

MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

Molecular Weight

Approximately 27 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DNA-binding protein HU-alpha Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71497
Quantity:
MCE Japan Authorized Agent: