DNase1L3 Protein, Mouse (His)

DNase1L3 protein has DNA hydrolytic activity and can effectively cleave single-stranded and double-stranded DNA to generate 3'-OH terminal fragments. It cleaves chromatin into nucleosomal units and participates in internucleosomal DNA fragmentation during apoptosis and necrosis. DNase1L3 Protein, Mouse (His) is the recombinant mouse-derived DNase1L3 protein, expressed by E. coli , with C-6*His labeled tag. The total length of DNase1L3 Protein, Mouse (His) is 285 a.a., with molecular weight of ~42 kDa.

DNase1L3 Protein exhibits DNA hydrolytic activity, proficient in both single- and double-stranded DNA cleavage, generating DNA fragments with 3'-OH ends. Capable of cleaving chromatin into nucleosomal units, it participates in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis. Its roles in apoptosis encompass myogenic and neuronal differentiation, as well as BCR-mediated clonal deletion of self-reactive B cells. Active on chromatin in apoptotic cell-derived membrane-coated microparticles, DNase1L3 suppresses anti-DNA autoimmunity. Alongside DNASE1, it plays a pivotal role in degrading neutrophil extracellular traps (NETs), composed mainly of DNA fibers, released by neutrophils to bind pathogens during inflammation. The concerted action of DNASE1 and DNASE1L3 in breaking down intravascular NETs is crucial for preventing the formation of clots that could obstruct blood vessels and lead to organ damage following inflammation.

Mouse

E. coli

C-6*His

O55070 (L26-S310)

13421  [NCBI]

LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS

Approximately 42 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6%Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.