DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)

Tnfrsf21 Protein, also known as death receptor 6 (DR6), CD358, or BM-018, is highly expressed in differentiating neurons as well as in the adult brain, and is upregulated in injured neurons. DR6 negatively regulates neuron, axon, and oligodendrocyte survival, hinders axondendrocyte and oligodendrocyte regeneration and its inhibition has a neuro-protective effect in nerve injury. It activates nuclear factor kappa-B (NFkB) and mitogen-activated protein kinase 8 (MAPK8, also called c-Jun N-terminal kinase 1), and induces cell apoptosis by associating with TNFRSF1A-associated via death domain (TRADD), which is known to mediate signal transduction of tumor necrosis factor receptors. DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-His labeled tag. The total length of DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is 309 a.a., with molecular weight of ~55-75 KDa.

Tnfrsf21 Protein promotes apoptosis, possibly via a pathway that involves the activation of NF-kappa-B, and can promote apoptosis mediated by BAX and by the release of cytochrome c from the mitochondria into the cytoplasm. Tnfrsf21 Protein plays a role in neuronal apoptosis, including apoptosis in response to amyloid peptides derived from APP, and is required for both normal cell body death and axonal pruning. Tnfrsf21 Protein also acts as a regulator of pyroptosis: recruits CASP8 in response to reactive oxygen species (ROS) and subsequent oxidation, leading to activation of GSDMC^[1][2][3].

Measured by its binding ability in a functional ELISA. When recombinant human APP770 is coated at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus DR6. The ED₅₀ for this effect is 368.4 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When recombinant human APP770 is coated at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus DR6. The ED₅₀ for this effect is 368.4 ng/mL.

Cynomolgus

HEK293

C-His

XP_005552846 (Q42-L350)

101925746  [NCBI]

QPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKEADNVCGTLPSFSSSTSPSPGTAIFSRPEHMDSHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL

Approximately 55-75 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.