1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Death Receptor 6
  6. DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)

DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P77352
Handling Instructions Technical Support

Tnfrsf21 Protein, also known as death receptor 6 (DR6), CD358, or BM-018, is highly expressed in differentiating neurons as well as in the adult brain, and is upregulated in injured neurons. DR6 negatively regulates neuron, axon, and oligodendrocyte survival, hinders axondendrocyte and oligodendrocyte regeneration and its inhibition has a neuro-protective effect in nerve injury. It activates nuclear factor kappa-B (NFkB) and mitogen-activated protein kinase 8 (MAPK8, also called c-Jun N-terminal kinase 1), and induces cell apoptosis by associating with TNFRSF1A-associated via death domain (TRADD), which is known to mediate signal transduction of tumor necrosis factor receptors. DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-His labeled tag. The total length of DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is 309 a.a., with molecular weight of ~55-75 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tnfrsf21 Protein, also known as death receptor 6 (DR6), CD358, or BM-018, is highly expressed in differentiating neurons as well as in the adult brain, and is upregulated in injured neurons. DR6 negatively regulates neuron, axon, and oligodendrocyte survival, hinders axondendrocyte and oligodendrocyte regeneration and its inhibition has a neuro-protective effect in nerve injury. It activates nuclear factor kappa-B (NFkB) and mitogen-activated protein kinase 8 (MAPK8, also called c-Jun N-terminal kinase 1), and induces cell apoptosis by associating with TNFRSF1A-associated via death domain (TRADD), which is known to mediate signal transduction of tumor necrosis factor receptors. DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-His labeled tag. The total length of DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is 309 a.a., with molecular weight of ~55-75 KDa.

Background

Tnfrsf21 Protein promotes apoptosis, possibly via a pathway that involves the activation of NF-kappa-B, and can promote apoptosis mediated by BAX and by the release of cytochrome c from the mitochondria into the cytoplasm. Tnfrsf21 Protein plays a role in neuronal apoptosis, including apoptosis in response to amyloid peptides derived from APP, and is required for both normal cell body death and axonal pruning. Tnfrsf21 Protein also acts as a regulator of pyroptosis: recruits CASP8 in response to reactive oxygen species (ROS) and subsequent oxidation, leading to activation of GSDMC[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. When recombinant human APP770 is coated at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus DR6. The ED50 for this effect is 368.4 ng/mL.

  • Measured by its binding ability in a functional ELISA. When recombinant human APP770 is coated at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus DR6. The ED50 for this effect is 368.4 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

XP_005552846 (Q42-L350)

Gene ID
Molecular Construction
N-term
DR6 (Q42-L350)
Accession # XP_005552846
His
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 21; CD358; Tnfrsf21; DR6
AA Sequence

QPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKEADNVCGTLPSFSSSTSPSPGTAIFSRPEHMDSHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL

Molecular Weight

Approximately 55-75 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77352
Quantity:
MCE Japan Authorized Agent: