DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His)

The DR6/TNFRSF21 protein participates in multiple cellular processes and promotes apoptosis through NF-kappa-B activation, BAX-mediated pathways, and cytochrome c release. It is critical for neuronal apoptosis, particularly in response to APP-derived amyloid peptides, and is critical for normal cell body death and axonal pruning. DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His) is 308 a.a., with molecular weight of 75-120 kDa.

The DR6/TNFRSF21 Protein is involved in multiple cellular processes. It promotes apoptosis through various pathways, including activation of NF-kappa-B, BAX-mediated apoptosis, and release of cytochrome c from mitochondria. It plays a crucial role in neuronal apoptosis, particularly in response to amyloid peptides derived from APP, and is essential for normal cell body death and axonal pruning. Additionally, it regulates oligodendrocyte survival, maturation, and myelination negatively. In the context of the adaptive immune response, it participates in signaling cascades triggered by T-cell receptors, influencing T-cell differentiation, proliferation, and cytokine release. Moreover, it inhibits JNK activation upon T-cell stimulation and negatively regulates IgG, IgM, and IgM production in response to antigens. It also functions as a regulator of pyroptosis, recruiting CASP8 in response to reactive oxygen species and oxidation, leading to GSDMC activation. The DR6/TNFRSF21 Protein interacts with NGFR, CASP8, and N-APP, and associates with TRADD.

Mouse

HEK293

C-hFc;C-6*His

Q9EPU5 (Q42-H349)

94185  [NCBI]

QPEQKTLSLPGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNMSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCKAHTDCLGQNLEVVKPGTKETDNVCGMRLFFSSTNPPSSGTVTFSHPEHMESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSGIEEGTVPDNTSSTSGKEGTNRTLPNPPQVTHQQAPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNAHKHFDINEH

75-120 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.