DSP Protein, Human (His-SUMO)

DSP proteins are major components of desmosomes and are critical for the structural integrity of various tissues. In cardiomyocytes, DSP regulates profibrotic gene expression through MAPK14/p38 MAPK activation and increased TGFB1 protein. DSP Protein, Human (His-SUMO) is the recombinant human-derived DSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of DSP Protein, Human (His-SUMO) is 223 a.a., with molecular weight of ~42.1 kDa.

DSP Protein takes center stage as a major high molecular weight component of desmosomes, crucial for maintaining structural integrity in various tissues. In cardiomyocytes, DSP plays a regulatory role in profibrotic gene expression through the activation of the MAPK14/p38 MAPK signaling cascade and an increase in TGFB1 protein abundance, as evidenced by similarity-based observations. Existing as a homodimer, DSP engages in dynamic interactions with key desmosomal components, such as COL17A1, DSC2, PKP2, and PKP1, showcasing its integral role in the complex architecture of desmosomal junctions. Furthermore, DSP demonstrates a weak interaction with TMEM65, highlighting its potential involvement in diverse cellular processes beyond desmosome assembly. The multifaceted functions of DSP underscore its significance in cellular structure and signaling pathways.

Human

E. coli

N-6*His;N-SUMO

P15924 (C78-D300)

1832  [NCBI]

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Approximately 42.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.