DUSP3 Protein, Human (His)

DUSP3, a dual-specificity phosphatase, preferentially dephosphorylates phosphotyrosines. Its main function involves inactivating ERK1 and ERK2, thereby modulating associated cellular signaling pathways. DUSP3 Protein, Human (His) is the recombinant human-derived DUSP3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of DUSP3 Protein, Human (His) is 184 a.a., with molecular weight of 18-22 kDa.

The DUSP3 protein exhibits dual phosphatase activity, targeting both tyrosine-protein phosphate and serine-protein phosphate, with a notable preference for phosphotyrosines. Its primary function involves the dephosphorylation and subsequent inactivation of ERK1 and ERK2, thereby modulating cellular signaling pathways associated with these kinases.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P51452 (S2-P185)

1845  [NCBI]

SGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

18-22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.