1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Phosphatase
  4. Protein tyrosine phosphatases
  5. Dual Specificity Phosphatase 3 (DUSP3)
  6. DUSP3 Protein, Human (His)

DUSP3 Protein, Human (His)

Cat. No.: HY-P71150
SDS COA Handling Instructions

DUSP3, a dual-specificity phosphatase, preferentially dephosphorylates phosphotyrosines. Its main function involves inactivating ERK1 and ERK2, thereby modulating associated cellular signaling pathways. DUSP3 Protein, Human (His) is the recombinant human-derived DUSP3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of DUSP3 Protein, Human (His) is 184 a.a., with molecular weight of 18-22 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DUSP3, a dual-specificity phosphatase, preferentially dephosphorylates phosphotyrosines. Its main function involves inactivating ERK1 and ERK2, thereby modulating associated cellular signaling pathways. DUSP3 Protein, Human (His) is the recombinant human-derived DUSP3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of DUSP3 Protein, Human (His) is 184 a.a., with molecular weight of 18-22 kDa.

Background

The DUSP3 protein exhibits dual phosphatase activity, targeting both tyrosine-protein phosphate and serine-protein phosphate, with a notable preference for phosphotyrosines. Its primary function involves the dephosphorylation and subsequent inactivation of ERK1 and ERK2, thereby modulating cellular signaling pathways associated with these kinases.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P51452 (S2-P185)

Gene ID
Molecular Construction
N-term
6*His
DUSP3 (S2-P185)
Accession # P51452
C-term
Synonyms
Dual specificity protein phosphatase 3; DUSP3; Dual specificity protein phosphatase VHR; Vaccinia H1-related phosphatase; VHR
AA Sequence

SGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

Molecular Weight

18-22 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DUSP3 Protein, Human (His)
Cat. No.:
HY-P71150
Quantity:
MCE Japan Authorized Agent: