E-selectin/CD62E Protein, Cynomolgus (HEK293, His)

The E-selectin/CD62E Protein, belonging to the selectin/LECAM family, plays a crucial role in mediating cell adhesion processes, particularly interactions between leukocytes and endothelial cells. As a member of this family, E-selectin likely shares conserved features, emphasizing its significance in cellular adhesion. Its study contributes to understanding inflammatory responses, immune cell trafficking, and potential therapeutic interventions. Further exploration of E-selectin/CD62E's role promises insights into its contributions to immune surveillance, inflammation, and broader cellular processes in both normal physiology and pathology. E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293, with C-His labeled tag. The total length of E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is 535 a.a., with molecular weight of 95-115 kDa.

The E-selectin/CD62E Protein is a vital member of the selectin/LECAM family, signifying its significant role in cell adhesion processes. As part of this family, E-selectin likely shares conserved structural and functional features with related proteins, indicating its involvement in mediating interactions between leukocytes and endothelial cells. The classification within the selectin/LECAM family underscores its specific designation within the broader context of cell adhesion molecules, providing insights into its unique contributions to cellular adhesion. The study of E-selectin/CD62E contributes to our understanding of its role in inflammatory responses and immune cell trafficking, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in immune surveillance and inflammation. Further exploration of E-selectin/CD62E's role holds promise for enhancing our knowledge of its contributions to normal physiology and pathological conditions.

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED₅₀ for this effect is 29.560 ng/mL, corresponding to a specific activity is 3.392×10⁴ units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED₅₀ for this effect is 29.560 ng/mL, corresponding to a specific activity is 3.392×104 units/mg.

Cynomolgus

HEK293

C-His

G8F370 (W22-P556)

/

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP

95-115 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.