2. Recombinant Proteins
  3. CD Antigens Receptor Proteins
  4. Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  5. E-Selectin/CD62E Selectin
  6. E-Selectin/CD62E
  7. E-Selectin/CD62E Protein, Rat (HEK293, Fc)

E-Selectin/CD62E Protein, Rat (HEK293, Fc)

Cat. No.: HY-P73043
Handling Instructions

The E-selectin/CD62E protein is a cell surface glycoprotein that critically mediates immune adhesion by promoting neutrophil adhesion to cytokine-activated endothelial cells through the SELPLG/PSGL1 interaction.It may also contribute to capillary morphogenesis and interact with SELPLG/PSGL1 and PODXL2 via the sialyl Lewis X epitope regardless of SELPLG sulfation.E-Selectin/CD62E Protein, Rat (HEK293, Fc) is the recombinant rat-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The E-selectin/CD62E protein is a cell surface glycoprotein that critically mediates immune adhesion by promoting neutrophil adhesion to cytokine-activated endothelial cells through the SELPLG/PSGL1 interaction.It may also contribute to capillary morphogenesis and interact with SELPLG/PSGL1 and PODXL2 via the sialyl Lewis X epitope regardless of SELPLG sulfation.E-Selectin/CD62E Protein, Rat (HEK293, Fc) is the recombinant rat-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag.
Background

E-Selectin/CD62E protein, a cell-surface glycoprotein, plays a pivotal role in immunoadhesion by mediating the adhesion of blood neutrophils to cytokine-activated endothelium through interaction with SELPLG/PSGL1. Beyond its immunological function, E-Selectin may contribute to capillary morphogenesis. The protein engages in interactions with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, with the noteworthy observation that SELPLG sulfation seems dispensable for this interaction. These findings underscore the diverse roles of E-Selectin in facilitating cellular adhesion events and suggest its potential involvement in processes related to vascular development.
Species

Rat
Source

HEK293
Tag

C-hFc
Accession

P98105 (W22-P494)
Gene ID
Molecular Construction
N-term
CD62E (W22-P494)
Accession # P98105
hFc
C-term
Synonyms
E-selectin; ELAM-1; LECAM2; CD62E; SELE
AA Sequence

MNASCFLSALTFVLLIGKSIAWYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSTLRYSPSYYWIGIRKVNNVWIWVGTQKPLTEEAKNWAPGEPNNKQRNEDCVEIYIQRPKDSGMWNDERCDKKKLALCYTASCTNTSCSGHGECVETINSYTCKCHPGFLGPKCDQVVTCQEQEYPDHGSLNCTHPFGLFSYNSSCSFSCERGYVPSSMETTVRCTSSGEWSAPAPACHVVECKALTQPAHGVRKCSSNPGSYPWNTTCTFDCEEGYRRVGAQNLQCTSSGVWDNEKPSCKAVTCDAIPRPQNGSVSCSNSTAGALAFKSSCNFTCEHSFTLQGPAQVECSAQGQWTPQIPVCKASQCEALSAPQRGHMKCLPSASAPFQSGSSCKFSCDEGFELKGSRRLQCGPRGEWDSEKPTCAGVQCSSLDLPGKMNMSCSGPAVFGTVCEFTCPEGWTLNGSSILTCGATGRWSAMLPTCEAPANPPRP

Molecular Weight

114-119 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

E-Selectin/CD62E Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
E-Selectin/CD62E Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73043
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.