1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. E-Selectin/CD62E Selectin
  5. E-Selectin/CD62E
  6. E-Selectin/CD62E Protein, Human (HEK293, His-Fc)

E-Selectin/CD62E Protein, Human (HEK293, His-Fc)

Cat. No.: HY-P74161
SDS COA Handling Instructions Technical Support

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-Selectin/CD62E Protein, Human (HEK293, His-Fc) is the recombinant human-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc, C-His labeled tag. The total length of E-Selectin/CD62E Protein, Human (HEK293, His-Fc) is 535 a.a., with molecular weight of 140-150 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-Selectin/CD62E Protein, Human (HEK293, His-Fc) is the recombinant human-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc, C-His labeled tag. The total length of E-Selectin/CD62E Protein, Human (HEK293, His-Fc) is 535 a.a., with molecular weight of 140-150 kDa.

Background

E-selectin/CD62E Protein is a cell-surface glycoprotein that plays a crucial role in immunoadhesion. It mediates the adhesion of blood neutrophils in cytokine-activated endothelium by interacting with SELPLG/PSGL1. Additionally, E-selectin/CD62E Protein may be involved in capillary morphogenesis. It interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, and it is worth noting that SELPLG sulfation is not necessary for this interaction.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to mouse E-Selectin/Fc Chimera coated plates (2 µg/mL with 100 µL/well), approximately 95.30% will adhere for 1 hour incubation at room temperature.

Species

Human

Source

HEK293

Tag

C-hFc;C-His

Accession

P16581 (W22-P556)

Gene ID
Synonyms
E-selectin; ELAM-1; LECAM2; CD62E; SELE
AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Molecular Weight

140-150 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

E-Selectin/CD62E Protein, Human (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
E-Selectin/CD62E Protein, Human (HEK293, His-Fc)
Cat. No.:
HY-P74161
Quantity:
MCE Japan Authorized Agent: