E-Selectin/CD62E Protein, Human (HEK293, His-Fc)

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-Selectin/CD62E Protein, Human (HEK293, His-Fc) is the recombinant human-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc, C-His labeled tag. The total length of E-Selectin/CD62E Protein, Human (HEK293, His-Fc) is 535 a.a., with molecular weight of 140-150 kDa.

E-selectin/CD62E Protein is a cell-surface glycoprotein that plays a crucial role in immunoadhesion. It mediates the adhesion of blood neutrophils in cytokine-activated endothelium by interacting with SELPLG/PSGL1. Additionally, E-selectin/CD62E Protein may be involved in capillary morphogenesis. It interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, and it is worth noting that SELPLG sulfation is not necessary for this interaction.

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 10⁴ cells/well are added to mouse E-Selectin/Fc Chimera coated plates (2 µg/mL with 100 µL/well), approximately 95.30% will adhere for 1 hour incubation at room temperature.

Human

HEK293

C-hFc;C-His

P16581 (W22-P556)

6401  [NCBI]

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

140-150 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.