EDA2R/XEDAR Protein, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of EDA2R/XEDAR Protein, Mouse (HEK293, His) is 138 a.a..

EDA2R/XEDAR Protein, identified as a receptor for EDA isoform A2 (but not A1), plays a pivotal role in mediating the activation of the NF-kappa-B and JNK pathways. The activation process appears to involve the binding of EDA2R/XEDAR to TRAF3 and TRAF6, as suggested by similarity with related proteins. Additionally, EDA2R/XEDAR associates with TRAF1, TRAF3, and TRAF6, further indicating its involvement in signaling pathways associated with immune and inflammatory responses. The intricate interactions and activation mechanisms underscore the significance of EDA2R/XEDAR in cellular signaling cascades, with potential implications in various physiological processes and cellular responses.

Mouse

HEK293

C-6*His

Q8BX35 (M1-T138)

245527  [NCBI]

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Approximately 26-29 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.