EDIL3 Protein, Human (HEK293, His, solution)

EDIL3 Protein enhances endothelial cell adhesion by interacting with the alpha-v/beta-3 integrin receptor, while also inhibiting the formation of vascular-like structures. Its role suggests involvement in the regulation of vascular morphogenesis during embryonic development. EDIL3 Protein, Human (HEK293, His, solution) is the recombinant human-derived EDIL3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of EDIL3 Protein, Human (HEK293, His, solution) is 457 a.a., with molecular weight of ~56 kDa.

The EDIL3 Protein plays a pivotal role in promoting the adhesion of endothelial cells by interacting with the alpha-v/beta-3 integrin receptor. Concurrently, EDIL3 exerts an inhibitory effect on the formation of vascular-like structures, suggesting its regulatory role in processes related to angiogenesis. This protein is implicated in the intricate orchestration of vascular morphogenesis and remodeling during embryonic development, highlighting its significance in shaping the vascular architecture. The dynamic interplay between EDIL3 and the alpha-v/beta-3 integrin receptor underscores its potential as a key mediator in cellular adhesion and the regulation of vascular morphogenesis, contributing to our understanding of fundamental processes crucial for embryonic development.

Human

HEK293

C-6*His

O43854-1 (D24-E480)

10085  [NCBI]

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Approximately 56 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 300 mM NaCl, pH 8.0 or 20 mM Citrate, 6% Trehalose, 4% Mannitol, 100 mM NaCl, 0.05% Tween 80, pH 5.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.