EDNRA Protein, Human (P.pastoris, His)

EDNRA Protein, a receptor for endothelin-1, activates a phosphatidylinositol-calcium second messenger system through association with G proteins. Its binding affinities follow the order: ET1 > ET2 >> ET3. Additionally, EDNRA interacts with HDAC7 and KAT5. EDNRA Protein, Human (P.pastoris, His) is the recombinant human-derived EDNRA protein, expressed by P. pastoris , with N-His labeled tag. The total length of EDNRA Protein, Human (P.pastoris, His) is 60 a.a., with molecular weight of ~62 kDa.

EDNRA, a pivotal player in cellular signaling, operates as a receptor for endothelin-1, executing its actions through G proteins and initiating a phosphatidylinositol-calcium second messenger system. This receptor exhibits varying binding affinities, with ET1 holding the highest affinity, followed by ET2 and ET3. Beyond its canonical functions in endothelin signaling, EDNRA engages in molecular interactions, forming complexes with HDAC7 and KAT5, potentially contributing to intricate cellular regulatory networks. The convergence of endothelin-1 signaling and protein interactions highlights the multifaceted role of EDNRA in orchestrating diverse cellular processes.

Human

P. pastoris

N-His

P25101 (D21-K80)

1909  [NCBI]

DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

Approximately 62 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.