EEF1E1 Protein, Human (His)

The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag. The total length of EEF1E1 Protein, Human (His) is 174 a.a., with molecular weight of 19-24 KDa.

EEF1E1, a positive modulator of the ATM response to DNA damage, is a crucial component of a multisubunit complex that orchestrates tRNA ligases for Arg (RARS1), Asp (DARS1), Gln (QARS1), Ile (IARS1), Leu (LARS1), Lys (KARS1), Met (MARS1), and the bifunctional ligase for Glu and Pro (EPRS1), along with the auxiliary subunits AIMP1/p43, AIMP2/p38, and EEF1E1/p18. It forms a linear complex containing MARS1, EEF1E1, EPRS1, and AIMP2 at its core. EEF1E1 exhibits simultaneous interaction with MARS1 and EPRS1, highlighting its integral role in the multisubunit complex. Additionally, EEF1E1 interacts with ATM and ATR. The interaction with ATM, independent of TP53, is induced by DNA damage resulting from genotoxic stress or cell growth, while the interaction with ATR is heightened in response to UV irradiation. This intricate network underscores EEF1E1's significance in coordinating DNA damage response mechanisms.

Human

E. coli

N-His

O43324 (M1-H174)

9521  [NCBI]

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Approximately 22 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.