EGF Protein, Human (HEK293, N-hFc)

The Progranulin/PGRN protein is involved in a variety of cellular processes, including cell growth, inflammation, and neurodegeneration. It acts as a regulator of tissue repair and has been implicated in the pathogenesis of several diseases, including Alzheimer's disease and frontotemporal dementia. Progranulin/PGRN interacts with various receptors and signaling pathways to exert its effects on cellular function and disease progression. EGF Protein, Human (HEK293, N-hFc) is the recombinant human-derived EGF protein, expressed by HEK293 , with N-hFc labeled tag.

The EGF Protein, a member of the epidermal growth factor superfamily, encodes a preproprotein that undergoes proteolytic processing to yield the 53-amino acid epidermal growth factor peptide. Functioning as a potent mitogenic factor, this protein plays a crucial role in the growth, proliferation, and differentiation of various cell types by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are associated with hypomagnesemia type 4, while dysregulation has been implicated in the growth and progression of certain cancers. Alternative splicing produces multiple transcript variants, including at least one encoding a preproprotein that undergoes proteolytic processing. Notably, the gene exhibits biased expression, with elevated levels in the kidney (RPKM 47.7), pancreas (RPKM 9.8), and one other tissue, highlighting its potential significance in these physiological contexts.

Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is <1.5 ng/mL.

• 
  Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 21.86 pg/mL, corresponding to a specific activity is 4.576×10⁷ Unit/mg.

Human

HEK293

N-hFc

NP_001954.2 (N971-R1023)

1950  [NCBI]

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Approximately 33-38 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.