1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Human (HEK293, N-hFc)

The Progranulin/PGRN protein is involved in a variety of cellular processes, including cell growth, inflammation, and neurodegeneration. It acts as a regulator of tissue repair and has been implicated in the pathogenesis of several diseases, including Alzheimer's disease and frontotemporal dementia. Progranulin/PGRN interacts with various receptors and signaling pathways to exert its effects on cellular function and disease progression. EGF Protein, Human (HEK293, N-hFc) is the recombinant human-derived EGF protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Progranulin/PGRN protein is involved in a variety of cellular processes, including cell growth, inflammation, and neurodegeneration. It acts as a regulator of tissue repair and has been implicated in the pathogenesis of several diseases, including Alzheimer's disease and frontotemporal dementia. Progranulin/PGRN interacts with various receptors and signaling pathways to exert its effects on cellular function and disease progression. EGF Protein, Human (HEK293, N-hFc) is the recombinant human-derived EGF protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The EGF Protein, a member of the epidermal growth factor superfamily, encodes a preproprotein that undergoes proteolytic processing to yield the 53-amino acid epidermal growth factor peptide. Functioning as a potent mitogenic factor, this protein plays a crucial role in the growth, proliferation, and differentiation of various cell types by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are associated with hypomagnesemia type 4, while dysregulation has been implicated in the growth and progression of certain cancers. Alternative splicing produces multiple transcript variants, including at least one encoding a preproprotein that undergoes proteolytic processing. Notably, the gene exhibits biased expression, with elevated levels in the kidney (RPKM 47.7), pancreas (RPKM 9.8), and one other tissue, highlighting its potential significance in these physiological contexts.

Biological Activity

Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <1.5 ng/mL.

  • Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 21.86 pg/mL, corresponding to a specific activity is 4.576×107 Unit/mg.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

NP_001954.2 (N971-R1023)

Gene ID
Molecular Construction
N-term
hFc
EGF (N971-R1023)
Accession # NP_001954.2
C-term
Synonyms
Pro-epidermal growth factor; Urogastrone; EGF; HOMG4
AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Weight

Approximately 33-38 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EGF Protein, Human (HEK293, N-hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Human (HEK293, N-hFc)
Cat. No.:
HY-P72982A
Quantity:
MCE Japan Authorized Agent: