1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Rat (Tag Free, Solution)

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Background

Epidermal Growth Factor is secreted by epithelial cells, promotes epithelial proliferation and migration in a variety of tissues, and increases epithelial wound closure and shortens healing time[1]. Epidermal Growth Factor plays a key role in skin development and homeostasis, shows a protective function in the epidermal barrier. Epidermal Growth Factor also displays an immunomodulatory activity in the inflamed skin tissue[2].

Biological Activity

Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED50 for this effect is typically 0.05-0.3ng/mL.

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

P07522 (N974-R1026)

Gene ID
Molecular Construction
N-term
EGF (N974-R1026)
Accession # P07522
C-term
Synonyms
rRtEGF; Pro-epidermal growth factor; Urogastrone
AA Sequence

MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Weight

Approximately 6.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

EGF Protein, Rat (Tag Free, Solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Rat (Tag Free, Solution)
Cat. No.:
HY-P7092Y
Quantity:
MCE Japan Authorized Agent: