1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Elafin/Trappin-2 Protein, Human (HEK293, His)

Elafin/Trappin-2, a skin-specific inhibitor of neutrophil and pancreatic elastase, safeguards tissues against elastase-mediated proteolysis. Its inhibitory range extends to the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor. Elafin/Trappin-2 also weakly inhibits Kv11.1/KCNH2/ERG1 and transient receptor potential cation channel subfamily V member 1 (TRPV1), as reported in studies. Elafin/Trappin-2 Protein, Human (HEK293, His) is the recombinant human-derived Elafin/Trappin-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Elafin/Trappin-2 Protein, Human (HEK293, His) is 95 a.a., with molecular weight of 13-15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Elafin/Trappin-2, a skin-specific inhibitor of neutrophil and pancreatic elastase, safeguards tissues against elastase-mediated proteolysis. Its inhibitory range extends to the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor. Elafin/Trappin-2 also weakly inhibits Kv11.1/KCNH2/ERG1 and transient receptor potential cation channel subfamily V member 1 (TRPV1), as reported in studies. Elafin/Trappin-2 Protein, Human (HEK293, His) is the recombinant human-derived Elafin/Trappin-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Elafin/Trappin-2 Protein, Human (HEK293, His) is 95 a.a., with molecular weight of 13-15 kDa.

Background

Elafin/Trappin-2, identified as a neutrophil and pancreatic elastase-specific inhibitor primarily found in the skin, serves as a protective factor against elastase-mediated tissue proteolysis. Its inhibitory properties extend beyond proteases, as it has demonstrated the ability to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor. Additionally, Elafin/Trappin-2 exerts a weak inhibitory effect on Kv11.1/KCNH2/ERG1 and the transient receptor potential cation channel subfamily V member 1 (TRPV1), as documented in studies.

Biological Activity

The inhibitory activity of the product has not been validated; activation with Cathepsin C may be required before product use.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P19957 (A23-Q117)

Gene ID
Molecular Construction
N-term
Elafin (A23-Q117)
Accession # P19957
6*His
C-term
Synonyms
rHuElafin, His; Elafin; Elastase-Specific Inhibitor; ESI; Peptidase Inhibitor 3; PI-3; Protease inhibitor WAP3; Skin-Derived Antileukoproteinase; SKALP; WAP Four-Disulfide Core Domain Protein 14; PI3; WAP3; WFDC14
AA Sequence

AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Molecular Weight

13-15 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Elafin/Trappin-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Elafin/Trappin-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70316
Quantity:
MCE Japan Authorized Agent: