2. Recombinant Proteins
  3. Others
  4. EN1 Protein, Gallus gallus (His-B2M)

EN1 Protein, Gallus gallus (His-B2M)

Cat. No.: HY-P72181
Handling Instructions

EN1 Protein is essential for the correct formation of the apical ectodermal ridge and accurate dorsal-ventral patterning in the limb. EN1 Protein, Gallus gallus (His-B2M) is the recombinant EN1 protein, expressed by E. coli , with N-6*His, B2M labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EN1 Protein is essential for the correct formation of the apical ectodermal ridge and accurate dorsal-ventral patterning in the limb. EN1 Protein, Gallus gallus (His-B2M) is the recombinant EN1 protein, expressed by E. coli , with N-6*His, B2M labeled tag.
Background

EN1 plays a pivotal role in embryonic development, specifically contributing to the proper formation of the apical ectodermal ridge and ensuring accurate dorsal-ventral patterning in limb development.
Species

Others
Source

E. coli
Tag

N-6*His;B2M
Accession

Q05916 (M1-E333)
Gene ID

771008  [NCBI]
Molecular Construction
N-term
6*His-B2M
EN1 (M1-333E)
Accession # Q05916
C-term
Synonyms
EN1; EN-1; Homeobox protein engrailed-1; Gg-En-1; Homeobox protein en-1
AA Sequence

MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE

Molecular Weight

Approximately 48.5 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

EN1 Protein, Gallus gallus (His-B2M) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EN1 Protein, Gallus gallus (His-B2M)
Cat. No.:
HY-P72181
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.