1. Recombinant Proteins
  2. Enzymes & Regulators
  3. ENSA Protein, Human (His)

ENSA Protein, Human (His)

Cat. No.: HY-P74175
SDS COA Handling Instructions

ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.

Background

ENSA protein, a pivotal phosphatase inhibitor, exerts precise control over protein phosphatase 2A (PP2A) during mitosis, specifically inhibiting its activity. Phosphorylation at Ser-67 during mitosis facilitates a specific interaction with PPP2R2D (PR55-delta), leading to the inactivation of PP2A. This orchestrated inactivation of PP2A is crucial for maintaining high cyclin-B1-CDK1 activity during the M phase, underscoring ENSA's regulatory role in cell cycle progression. Beyond its mitotic functions, ENSA also operates as a stimulator of insulin secretion by interacting with the sulfonylurea receptor (ABCC8), preventing sulfonylurea binding and reducing K(ATP) channel currents. Notably, ENSA's interactions with PPP2R2D and ABCC8 highlight its diverse roles in both cell cycle control and insulin secretion regulation, showcasing its significance in maintaining cellular homeostasis and functional integrity. Additionally, ENSA's interaction with SNCA, disrupted upon phosphorylation at Ser-109, further emphasizes its dynamic involvement in cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O43768-1 (M1-E121)

Gene ID
Molecular Construction
N-term
6*His
ENSA (M1-E121)
Accession # O43768-1
C-term
Synonyms
Alpha-endosulfine; ARPP-19e; ENSA
AA Sequence

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ENSA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ENSA Protein, Human (His)
Cat. No.:
HY-P74175
Quantity:
MCE Japan Authorized Agent: