ENSA Protein, Human (His)

ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.

ENSA protein, a pivotal phosphatase inhibitor, exerts precise control over protein phosphatase 2A (PP2A) during mitosis, specifically inhibiting its activity. Phosphorylation at Ser-67 during mitosis facilitates a specific interaction with PPP2R2D (PR55-delta), leading to the inactivation of PP2A. This orchestrated inactivation of PP2A is crucial for maintaining high cyclin-B1-CDK1 activity during the M phase, underscoring ENSA's regulatory role in cell cycle progression. Beyond its mitotic functions, ENSA also operates as a stimulator of insulin secretion by interacting with the sulfonylurea receptor (ABCC8), preventing sulfonylurea binding and reducing K(ATP) channel currents. Notably, ENSA's interactions with PPP2R2D and ABCC8 highlight its diverse roles in both cell cycle control and insulin secretion regulation, showcasing its significance in maintaining cellular homeostasis and functional integrity. Additionally, ENSA's interaction with SNCA, disrupted upon phosphorylation at Ser-109, further emphasizes its dynamic involvement in cellular processes.

Human

E. coli

N-6*His

O43768-1 (M1-E121)

2029  [NCBI]

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Approximately 17 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.