Enterotoxin type A Protein, S. aureus (sf9, His-Myc)

Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (sf9, His-Myc) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag.

Enterotoxin type A (ETA) is a staphylococcal enterotoxin that instigates host immune system activation by binding in its unprocessed form to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction sets off a cascade of events involving waves of cellular activation, cytokine production, and migration, primarily mediated by alphabeta T-cells, ultimately affecting lung tissue and airways. Additionally, ETA is implicated in the development of staphylococcal food poisoning syndrome, characterized by symptoms such as high fever, hypotension, diarrhea, shock, and, in severe cases, potential fatality.

Staphylococcus aureus

Sf9 insect cells

N-10*His;C-Myc

P0A0L2 (S25-S257)

/

SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS

Approximately 31.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.