1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Enterotoxin type A Protein, S. aureus (His)

Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (His) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by E. coli , with N-6*His labeled tag. The total length of Enterotoxin type A Protein, S. aureus (His) is 233 a.a., with molecular weight of ~28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (His) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by E. coli , with N-6*His labeled tag. The total length of Enterotoxin type A Protein, S. aureus (His) is 233 a.a., with molecular weight of ~28 kDa.

Background

Enterotoxin type A (ETA) is a staphylococcal enterotoxin that instigates host immune system activation by binding in its unprocessed form to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction sets off a cascade of events involving waves of cellular activation, cytokine production, and migration, primarily mediated by alphabeta T-cells, ultimately affecting lung tissue and airways. Additionally, ETA is implicated in the development of staphylococcal food poisoning syndrome, characterized by symptoms such as high fever, hypotension, diarrhea, shock, and, in severe cases, potential fatality.

Species

Staphylococcus aureus

Source

E. coli

Tag

N-6*His

Accession

P0A0L2 (S25-S257)

Gene ID

/

Molecular Construction
N-term
6*His
SEA (S25-S257)
Accession # P0A0L2
C-term
Synonyms
entAEnterotoxin type A; SEA
AA Sequence

SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS

Molecular Weight

Approximately 28 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Enterotoxin type A Protein, S. aureus (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterotoxin type A Protein, S. aureus (His)
Cat. No.:
HY-P71509
Quantity:
MCE Japan Authorized Agent: