Enterotoxin type G Protein, S. aureus (His-SUMO)

Enterotoxin type G Proteinas, a staphylococcal enterotoxin, is implicated in staphylococcal food poisoning syndrome, causing severe symptoms like high fever, hypotension, diarrhea, shock, and fatalities. Its ability to induce a range of adverse effects underscores its significance in foodborne illnesses, emphasizing the severity of impact on affected individuals. Enterotoxin type G Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived Enterotoxin type G protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Enterotoxin type G Protein, S. aureus (His-SUMO) is 233 a.a., with molecular weight of ~43.0 kDa.

Enterotoxin type G, a member of staphylococcal enterotoxins, is implicated in the development of staphylococcal food poisoning syndrome. This syndrome is characterized by severe symptoms, including high fever, hypotension, diarrhea, shock, and, in some cases, fatalities. The enterotoxin's ability to induce such a range of adverse effects underscores its significance in the context of foodborne illnesses and highlights the severity of its impact on affected individuals.

Staphylococcus aureus

E. coli

N-His;N-SUMO

P0A0L7 (Q26-H258)

/

QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

Approximately 43.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.