1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Enterotoxin type G Protein, S. aureus (His-SUMO)

Enterotoxin type G Protein, S. aureus (His-SUMO)

Cat. No.: HY-P71486
Handling Instructions Technical Support

Enterotoxin type G Proteinas, a staphylococcal enterotoxin, is implicated in staphylococcal food poisoning syndrome, causing severe symptoms like high fever, hypotension, diarrhea, shock, and fatalities. Its ability to induce a range of adverse effects underscores its significance in foodborne illnesses, emphasizing the severity of impact on affected individuals. Enterotoxin type G Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived Enterotoxin type G protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Enterotoxin type G Protein, S. aureus (His-SUMO) is 233 a.a., with molecular weight of ~43.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Enterotoxin type G Proteinas, a staphylococcal enterotoxin, is implicated in staphylococcal food poisoning syndrome, causing severe symptoms like high fever, hypotension, diarrhea, shock, and fatalities. Its ability to induce a range of adverse effects underscores its significance in foodborne illnesses, emphasizing the severity of impact on affected individuals. Enterotoxin type G Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived Enterotoxin type G protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Enterotoxin type G Protein, S. aureus (His-SUMO) is 233 a.a., with molecular weight of ~43.0 kDa.

Background

Enterotoxin type G, a member of staphylococcal enterotoxins, is implicated in the development of staphylococcal food poisoning syndrome. This syndrome is characterized by severe symptoms, including high fever, hypotension, diarrhea, shock, and, in some cases, fatalities. The enterotoxin's ability to induce such a range of adverse effects underscores its significance in the context of foodborne illnesses and highlights the severity of its impact on affected individuals.

Species

Staphylococcus aureus

Source

E. coli

Tag

N-His;N-SUMO

Accession

P0A0L7 (Q26-H258)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
SEG (Q26-H258)
Accession # P0A0L7
C-term
Synonyms
entG; seg; SA1642Enterotoxin type G; SEG
AA Sequence

QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

Molecular Weight

Approximately 43.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Enterotoxin type G Protein, S. aureus (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterotoxin type G Protein, S. aureus (His-SUMO)
Cat. No.:
HY-P71486
Quantity:
MCE Japan Authorized Agent: