1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Enterotoxin type H Protein, S. aureus (P.pastoris, His)

Enterotoxin type H Protein, S. aureus (P.pastoris, His)

Cat. No.: HY-P71807
Handling Instructions Technical Support

Enterotoxin (ETH) activates the host immune system by binding as a raw molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules, specifically through its alpha domain, specifically TRAV27 . This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type H Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Enterotoxin type H protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Enterotoxin (ETH) activates the host immune system by binding as a raw molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules, specifically through its alpha domain, specifically TRAV27 . This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type H Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Enterotoxin type H protein, expressed by P. pastoris , with N-His labeled tag.

Background

Enterotoxin type H (ETH) is a staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules, notably through their alpha domain, particularly TRAV27. This interaction forms a ternary complex that, in turn, triggers the activation of a substantial number of T-lymphocytes, initiating a widespread release of pro-inflammatory cytokines. Additionally, ETH is implicated in the development of staphylococcal food poisoning syndrome, a condition characterized by symptoms such as high fever, hypotension, diarrhea, shock, and, in severe cases, potential fatality.

Species

Staphylococcus aureus

Source

P. pastoris

Tag

N-His

Accession

P0A0M0 (E25-V241)

Gene ID

/

Molecular Construction
N-term
His
SHE (E25-V241)
Accession # P0A0M0
C-term
Synonyms
entH; sehEnterotoxin type H; SEH
AA Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Molecular Weight

Approximately 27.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Enterotoxin type H Protein, S. aureus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterotoxin type H Protein, S. aureus (P.pastoris, His)
Cat. No.:
HY-P71807
Quantity:
MCE Japan Authorized Agent: