1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. Ephrin/Eph Family Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. Eph Receptors
  5. EphA10
  6. EphA10 Protein, Mouse (HEK293, His)

EphA10 Protein, Mouse (HEK293, His)

Cat. No.: HY-P77648
COA Handling Instructions

EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EphA10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA10 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EphA10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA10 protein, expressed by HEK293 , with C-His labeled tag.

Background

EphA10, identified as a receptor for members of the ephrin-A family, plays a crucial role in cellular signaling. Specifically, it acts as a receptor for ephrin ligands EFNA3, EFNA4, and EFNA5. The interaction between EphA10 and these ephrin-A family members suggests its involvement in diverse cellular processes, likely including cell-cell communication and regulation of tissue development. This receptor-ligand binding capacity highlights EphA10's significance in mediating signaling events that contribute to various physiological and developmental processes.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q8BYG9-1 (L23-A565)

Gene ID
Molecular Construction
N-term
EphA10 (L23-A565)
Accession # Q8BYG9-1
His
C-term
Synonyms
EphA10; FLJ16103; FLJ33655; MGC43817
AA Sequence

LLLGPGRPGTAEEVILLDSKASQAELGWTALPSTGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGATGTCKETFNAYYLETETDLGRGRPRLGGNRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRQGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTCVAHSEGEPSSPPRMHCGADGEWLVPVGRCSCSAGFQEHGDICEACPPGFYKVSPRRPLCSPCPEHSLALENASTFCVCQDTYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGRDGPAGACQPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGATYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPVPAGAPGTNSTEYEIRYYEKGQSEQTYSTVKTGAPAVTVTNLKPATRYVFQIRAASPGPLWEAQSFSPSIEVQTPGEVAPGSRDQSPA

Molecular Weight

68-80 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EphA10 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77648
Quantity:
MCE Japan Authorized Agent: