EphA2 Protein, Mouse (HEK293, His)

EphA2 protein is a receptor tyrosine kinase that promiscuously binds to ephrin A ligands to initiate bidirectional signaling. EphA2 is activated by ephrin-A1/EFNA1, regulates cell migration, adhesion, proliferation and differentiation, modulates DSG1 and inhibits ERK1/ERK2 signaling. EphA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA2 protein, expressed by HEK293 , with C-His labeled tag. The total length of EphA2 Protein, Mouse (HEK293, His) is 510 a.a., with molecular weight of ~65-95 kDa.

The EphA2 protein, a receptor tyrosine kinase, engages in promiscuous binding to membrane-bound ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the pathway downstream of the ephrin ligand is termed reverse signaling. Activated by the ligand ephrin-A1/EFNA1, EphA2 plays a regulatory role in cell migration, integrin-mediated adhesion, proliferation, and differentiation. Additionally, EphA2 modulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibits the ERK1/ERK2 signaling pathway. It may also participate in UV radiation-induced apoptosis and exhibit a ligand-independent stimulatory effect on chemotactic cell migration. During development, EphA2 functions in various aspects of pattern formation and contributes to the development of several fetal tissues, including angiogenesis, early hindbrain development, and epithelial proliferation and branching morphogenesis during mammary gland development. Interaction with the ligand ephrin-A5/EFNA5 may regulate lens fiber cells' shape and interactions, playing a crucial role in lens transparency development and maintenance. Furthermore, in collaboration with ephrin-A2/EFNA2, EphA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis.

Measured by its binding ability in a functional ELISA. Immobilized mouse EphA2 at 2 μg/mL (100 μl/well) can bind mouse EphrinA1 with a linear range of 0.16-20 ng/mL.

• 
  Immobilized Recombinant Mouse EphA2 Proteinat 2 μg/mL (100 μL/well) can bind Recombinant Mouse Ephrin-A1 / EFNA1 Protein, the ED₅₀ is 11.4 ng/mL.

Mouse

HEK293

C-His

Q03145 (K26-N535)

13836  [NCBI]

KEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSAN

Approximately 65-95 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 5%Trehalose, 5% Mannitol, 0.01%Tween-80, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.