EphB1 Protein, Human (sf9, His-GST)

The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

The EphB1 protein, a receptor tyrosine kinase, engages in promiscuous binding to transmembrane ephrin-B family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the signaling pathway downstream of the ephrin ligand is termed reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2, and EFNB3. In nervous system development, EphB1 regulates retinal axon guidance by redirecting ipsilaterally ventrotemporal retinal ganglion cell axons at the optic chiasm midline, likely through repulsive interaction with EFNB2. In the adult nervous system, in conjunction with EFNB3, EphB1 governs chemotaxis, proliferation, and polarity of hippocampal neural progenitors. Beyond its role in axon guidance, EphB1 plays a crucial redundant role with other ephrin-B receptors in the development and maturation of dendritic spines and synapse formation. Additionally, EphB1 may regulate angiogenesis and, more generally, play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and possibly other ephrin-B ligands, EphB1 activates the MAPK/ERK and JNK signaling cascades to regulate cell migration and adhesion, respectively. Moreover, EphB1 is involved in maintaining the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation.

Human

Sf9 insect cells

N-His;N-GST

AAI11745.1 (R565-A984)

2047  [NCBI]

RKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA

Approximately 66 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.