Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is 164 a.a., with molecular weight of ~27 kDa.

The Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, serves a pivotal role in migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, instigating contact-dependent bidirectional signaling. Crucial in angiogenesis and tumor neovascularization, EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration depend on the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2. Notably, EFNA1 exerts anti-oncogenic effects by activating and down-regulating EPHA2 through induced tyrosine phosphorylation, leading to internalization and degradation. In gliomas, it acts as a negative regulator, down-regulating EPHA2 and FAK and thus playing a role in suppressing tumorigenesis. EFNA1 can induce the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as both a monomer and homodimer, it forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases including EPHA1, EPHA3, EPHA4, EPHA5, EPHA6, and EPHA7.

Mouse

HEK293

C-His

P52793 (D19-S182)

13636  [NCBI]

MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS

Approximately 27 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.