Ephrin-A2/EFNA2 Protein, Mouse (HEK293)

Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with tag free.

The Ephrin-A2/EFNA2 protein, a cell surface GPI-bound ligand for Eph receptors, is integral to neuronal, vascular, and epithelial development, where Eph receptors play a crucial role in migration, repulsion, and adhesion. EFNA2 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. In association with the EPHA2 receptor, EFNA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis. This protein also binds to the receptor tyrosine kinases EPHA3, EPHA4, and EPHA5. Furthermore, EFNA2 interacts with EPHA8, activating this receptor and potentially influencing additional cellular processes. The multifaceted interactions of EFNA2 underscore its significance in orchestrating complex signaling events that impact diverse developmental and regulatory pathways.

Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 9.733 ng/mL, corresponding to a specific activity is 1.027×10⁵ units/mg.

• 
  Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 9.733 ng/mL, corresponding to a specific activity is 1.027×10⁵ units/mg.

Mouse

HEK293

Tag Free

P52801 (R21-N184)

13637  [NCBI]

RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN

Approximately 24-28 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.