1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A3
  6. Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc)

Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc) is 191 a.a., with molecular weight of 60-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc) is 191 a.a., with molecular weight of 60-65 kDa.

Background

Ephrin-A3 (EFNA3) is a cell surface glycosylphosphatidylinositol (GPI)-bound ligand that plays a pivotal role in cellular interactions during development. It belongs to the Eph receptor family, a group of receptor tyrosine kinases crucial for processes such as migration, repulsion, and adhesion in neuronal, vascular, and epithelial tissues. EFNA3 exhibits promiscuous binding to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. This bidirectional signaling involves the forward signaling pathway downstream of the receptor and the reverse signaling pathway downstream of the ephrin ligand. Furthermore, EFNA3 specifically interacts with EPHA8, activating the receptor and contributing to downstream signaling events.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P52797 (Q23-S213)

Gene ID
Molecular Construction
N-term
EFNA3 (Q23-S213)
Accession # P52797
hFc
C-term
Synonyms
Ephrin-A3; EFL-2; EHK1-L; LERK-3; EFNA3; EFL2; EPLG3
AA Sequence

MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Molecular Weight

60-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73007
Quantity:
MCE Japan Authorized Agent: