Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)

Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is 183 a.a., with molecular weight of ~38 kDa.

Ephrin-A3/EFNA3 Protein is a cell surface GPI-bound ligand that plays a critical role in neuronal, vascular, and epithelial development by interacting with Eph receptors, a family of receptor tyrosine kinases involved in migration, repulsion, and adhesion. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling. The receptor's downstream signaling is known as forward signaling, while the ephrin ligand's downstream signaling is referred to as reverse signaling. Ephrin-A3/EFNA3 also interacts with EPHA8 and activates this receptor, further contributing to its regulatory functions.

Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×10⁴ units/mg.

• 
  Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×10⁴ units/mg.

Mouse

HEK293

C-His

O08545 (Q23-S205)

13638  [NCBI]

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Approximately 38 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.