1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A3
  6. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)

Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)

Cat. No.: HY-P73009
SDS COA Handling Instructions

Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is 183 a.a., with molecular weight of ~38 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is 183 a.a., with molecular weight of ~38 kDa.

Background

Ephrin-A3/EFNA3 Protein is a cell surface GPI-bound ligand that plays a critical role in neuronal, vascular, and epithelial development by interacting with Eph receptors, a family of receptor tyrosine kinases involved in migration, repulsion, and adhesion. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling. The receptor's downstream signaling is known as forward signaling, while the ephrin ligand's downstream signaling is referred to as reverse signaling. Ephrin-A3/EFNA3 also interacts with EPHA8 and activates this receptor, further contributing to its regulatory functions.

Biological Activity

Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×104 units/mg.

  • Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×104 units/mg.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

O08545 (Q23-S205)

Gene ID
Molecular Construction
N-term
EFNA3 (Q23-S205)
Accession # O08545
His
C-term
Synonyms
Ephrin-A3; EFL-2; EHK1-L; LERK-3; EFNA3; EFL2; EPLG3
AA Sequence

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Molecular Weight

Approximately 38 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73009
Quantity:
MCE Japan Authorized Agent: