Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His)

Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His) is 151 a.a., with molecular weight of ~25 kDa.

Ephrin-A4 (EFNA4) is a cell surface glycosylphosphatidylinositol (GPI)-bound ligand that belongs to the Eph receptor family, a group of receptor tyrosine kinases crucial for various developmental processes, including migration, repulsion, and adhesion in neurons, vascular tissues, and epithelial cells. EFNA4 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. This interaction is essential for orchestrating complex cellular events during development. Moreover, EFNA4 may contribute to the interaction between activated B-lymphocytes and dendritic cells in tonsils, suggesting its involvement in immune responses.

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ephrin-A4 at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse EPHA7. The ED₅₀ for this effect is 1.214μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse Ephrin-A4 at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse EPHA7. The ED₅₀ for this effect is 1.214 μg/mL.

Mouse

HEK293

C-His

O08542 (L26-G176)

13639  [NCBI]

LRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG

Approximately 25 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.