1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His)

Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70194
Handling Instructions Technical Support

Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Ephrin-A5/EFNA5 protein, a cell surface GPI-bound ligand for Eph receptors, plays a pivotal role in neuronal, vascular, and epithelial development, where Eph receptors are critical for migration, repulsion, and adhesion. EFNA5 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. This protein induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor, a process requiring the activity of the Fyn tyrosine kinase. EFNA5 activates the EPHA3 receptor, regulating cell-cell adhesion and cytoskeletal organization, and, in conjunction with EPHA2, potentially contributes to shaping lens fiber cells and maintaining lens transparency. It may actively stimulate axon fasciculation and mediate communication between pancreatic islet cells, influencing glucose-stimulated insulin secretion. As a cognate ligand for EPHA7, EFNA5 regulates brain development by modulating cell-cell adhesion and repulsion. It binds to the receptor tyrosine kinases EPHA2, EPHA3, and EPHB1 and forms a ternary complex with EPHA3 and ADAM10, mediating EFNA5 extracellular domain shedding by ADAM10, which in turn regulates the internalization and function of the EFNA5-EPHA3 complex. EFNA5 also binds to EPHB2 and interacts with EPHA8, activating the latter receptor.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

O08543 (Q21-Q206)

Gene ID
Molecular Construction
N-term
EFNA5 (Q21-Q206)
Accession # O08543
6*His
C-term
Synonyms
rMuEphrin-A5, His ; Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; Epl7; Eplg7; Lerk7; Efna5;
AA Sequence

QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ

Molecular Weight

25-28 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70194
Quantity:
MCE Japan Authorized Agent: