1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Ephrin/Eph Family Cytokine Receptors
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin-A5/EFNA5 Protein, Rat (HEK293, Fc)

The Ephrin-A5/EFNA5 protein is an important cell surface ligand that plays an important role in neuronal, vascular, and epithelial development. It binds to Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion, cytoskeletal organization, and lens transparency. Ephrin-A5/EFNA5 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A5/EFNA5 Protein, Rat (HEK293, Fc) is 182 a.a., with molecular weight of ~55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ephrin-A5/EFNA5 protein is an important cell surface ligand that plays an important role in neuronal, vascular, and epithelial development. It binds to Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion, cytoskeletal organization, and lens transparency. Ephrin-A5/EFNA5 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A5/EFNA5 Protein, Rat (HEK293, Fc) is 182 a.a., with molecular weight of ~55 kDa.

Background

The Ephrin-A5/EFNA5 protein, a cell surface GPI-bound ligand for Eph receptors, plays a crucial role in neuronal, vascular, and epithelial development, where Eph receptors are essential for migration, repulsion, and adhesion. EFNA5 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. When bound to its cognate receptor, EFNA5 induces compartmentalized signaling within a caveolae-like membrane microdomain, requiring the activity of the Fyn tyrosine kinase. It activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization, and in association with EPHA2, may play a role in shaping lens fiber cells and maintaining lens transparency. Additionally, EFNA5 stimulates axon fasciculation and mediates communication between pancreatic islet cells, regulating glucose-stimulated insulin secretion through its interaction with EPHA5. It is also a cognate ligand for EPHA7, influencing brain development by modulating cell-cell adhesion and repulsion. Furthermore, EFNA5 interacts with EPHA8, activating this receptor, and forms a ternary complex with EPHA3 and ADAM10, mediating extracellular domain shedding and regulating the internalization and function of the EFNA5-EPHA3 complex.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P97605 (Q21-E202)

Gene ID
Molecular Construction
N-term
EFNA5 (Q21-E202)
Accession # P97605
hFc
C-term
Synonyms
Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7
AA Sequence

MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFDVNDKVENSLEPADDTVHESAEPSRGE

Molecular Weight

Approximately 55 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-A5/EFNA5 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A5/EFNA5 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73013
Quantity:
MCE Japan Authorized Agent: