Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)

Ephrin-B1/EFNB1 Protein, a type I membrane protein, acts as a ligand for Eph-related receptor tyrosine kinases, potentially influencing cell adhesion and contributing to nervous system development. With ubiquitous expression, it is notably present in fat, placenta, and various tissues, showcasing its broad impact on diverse cellular and physiological contexts. Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) is 210 a.a., with molecular weight of approximately 58.76 kDa.

Ephrin-B1/EFNB1 Protein, a type I membrane protein, serves as a ligand for Eph-related receptor tyrosine kinases. Its involvement extends to potential roles in cell adhesion, contributing to the intricate processes of nervous system development or maintenance. Exhibiting ubiquitous expression, this protein is notably present in fat (RPKM 27.2), placenta (RPKM 17.2), and 23 other tissues, highlighting its wide-ranging influence across various cellular and physiological contexts.

Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ this effect is 2.876 ng/mL, corresponding to a specific activity is 3.4771×10^5 units/mg.

• 
  Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ this effect is 2.876 ng/mL, corresponding to a specific activity is 3.4771×10⁵ units/mg.

Human

HEK293

C-hFc

NP_004420.1 (L28-K237)

1947  [NCBI]

LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSK

approximately 58.76 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.