Ephrin-B1/EFNB1 Protein, Human (HEK293, His-Fc)

Ephrin-B1/EFNB1 Protein, a transmembrane ligand, interacts with Eph receptors, facilitating bidirectional signaling. It binds EPHB1/ELK and EPHB2/3, inducing axon collapse and growth cone orientation. EFNB1 also interacts with GRIP1/2, TLE1, and enhances ZHX2's transcriptional repression activity. These interactions highlight EFNB1's role in diverse developmental processes. Ephrin-B1/EFNB1 Protein, Human (HEK293, His-Fc) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-8*His, C-hFc labeled tag. The total length of Ephrin-B1/EFNB1 Protein, Human (HEK293, His-Fc) is 210 a.a., with molecular weight of ~64 & 36 kDa, respectively.

Ephrin-B1/EFNB1 Protein is a cell surface transmembrane ligand that interacts with Eph receptors, a family of receptor tyrosine kinases, crucial for neuronal, vascular, and epithelial development. This binding leads to contact-dependent bidirectional signaling between neighboring cells. Ephrin-B1/EFNB1 shows high affinity for the receptor tyrosine kinase EPHB1/ELK and can also bind EPHB2 and EPHB3. In vitro studies demonstrate that it can induce the collapse of commissural axons and growth cones, suggesting a role in orienting longitudinally projecting axons. Ephrin-B1/EFNB1 interacts with GRIP1 and GRIP2 through its PDZ-binding motif and with TLE1. Additionally, the intracellular domain peptide of Ephrin-B1/EFNB1 interacts with ZHX2, enhancing ZHX2's transcriptional repression activity.

Human

HEK293

C-8*His;C-hFc

P98172 (L28-K237)

1947  [NCBI]

LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSK

Approximately 64&36 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.