Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc)

Ephrin-B1 (EFNB1) protein binds to Eph family receptors, enabling signaling between receptor-expressing cells and cells with EFNB1. It is crucial for neuronal axon growth and expressed in various tissues like the adult lung and colon, highlighting its widespread presence and importance in mediating cellular interactions. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is 200 a.a., with molecular weight of 55-75 kDa.

Ephrin-B1 (EFNB1) protein, encoded by this gene, functions as a membrane ligand for Eph family receptors, facilitating bidirectional signaling between the cell expressing the receptor and the cell containing this protein. Critical for various developmental processes, its activity plays a key role in neuronal axon growth. The widespread expression of EFNB1, observed across multiple tissues such as the adult lung and colon, emphasizes its ubiquitous presence and underscores its significance in mediating essential cellular interactions during development and beyond.

Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ this effect is 7.89 ng/mL, corresponding to a specific activity is 1.267×10⁵ U/mg.

• 
  Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ this effect is 7.89 ng/mL, corresponding to a specific activity is 1.267×10⁵ U/mg.

Mouse

HEK293

C-hFc

NP_034240.1 (K30-S229)

13641  [NCBI]

KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

55-75 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.