1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-B1
  6. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc)

Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P73027
SDS COA Handling Instructions

Ephrin-B1 (EFNB1) protein binds to Eph family receptors, enabling signaling between receptor-expressing cells and cells with EFNB1. It is crucial for neuronal axon growth and expressed in various tissues like the adult lung and colon, highlighting its widespread presence and importance in mediating cellular interactions. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is 200 a.a., with molecular weight of 55-75 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-B1 (EFNB1) protein binds to Eph family receptors, enabling signaling between receptor-expressing cells and cells with EFNB1. It is crucial for neuronal axon growth and expressed in various tissues like the adult lung and colon, highlighting its widespread presence and importance in mediating cellular interactions. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is 200 a.a., with molecular weight of 55-75 kDa.

Background

Ephrin-B1 (EFNB1) protein, encoded by this gene, functions as a membrane ligand for Eph family receptors, facilitating bidirectional signaling between the cell expressing the receptor and the cell containing this protein. Critical for various developmental processes, its activity plays a key role in neuronal axon growth. The widespread expression of EFNB1, observed across multiple tissues such as the adult lung and colon, emphasizes its ubiquitous presence and underscores its significance in mediating essential cellular interactions during development and beyond.

Biological Activity

Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 7.89 ng/mL, corresponding to a specific activity is 1.267×105 U/mg.

  • Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 7.89 ng/mL, corresponding to a specific activity is 1.267×105 U/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

NP_034240.1 (K30-S229)

Gene ID
Molecular Construction
N-term
EFNB1 (K30-S229)
Accession # NP_034240.1
hFc
C-term
Synonyms
Ephrin-B1; EFL-3; ELK-L; LERK-2; Ephrin-B1 CTF; EFNB1; EFL3; EPLG2; LERK2
AA Sequence

KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

Molecular Weight

55-75 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73027
Quantity:
MCE Japan Authorized Agent: