Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.

Ephrin-B1/EFNB1 protein, a cell surface transmembrane ligand for Eph receptors crucial in neuronal, vascular, and epithelial development, engages in contact-dependent bidirectional signaling by binding to Eph receptors on adjacent cells. With high affinity for the receptor tyrosine kinase EPHB1/ELK, EFNB1 can also bind EPHB2 and EPHB3. In vitro, EFNB1 binds to commissural axons/growth cones, inducing their collapse and potentially playing a role in constraining the orientation of longitudinally projecting axons. The protein's interactions extend to binding with GRIP1 and GRIP2 via its PDZ-binding motif, and it interacts with TLE1. Moreover, EFNB1's intracellular domain peptide interacts with ZHX2, enhancing ZHX2's transcriptional repression activity. These multifaceted interactions underscore EFNB1's role in orchestrating intricate signaling events, contributing to various developmental processes and cellular functions.

Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphB3 (HY-P75749) at 2 µg/mL (100 µL/well) can bind Recombinant Rat Ephrin-B1. The ED₅₀ for this effect is 0.2752 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphB3 (HY-P75749) at 2 µg/mL (100 µL/well) can bind Recombinant Rat Ephrin-B1. The ED₅₀ for this effect is 0.2752 ng/mL.

Rat

HEK293

C-His

P52796 (A25-T229)

25186  [NCBI]

ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDT

Approximately 29-40 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

<1 EU/μg, determined by LAL method.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.