1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin B2
  6. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His)

Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His)

Cat. No.: HY-P70378
Handling Instructions Technical Support

Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is 199 a.a., with molecular weight of 65-80 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is 199 a.a., with molecular weight of 65-80 kDa.

Background

Ephrin-B2/EFNB2 Protein is a cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases that play crucial roles in neuronal, vascular, and epithelial development. It binds to neighboring cells' Eph receptors, leading to contact-dependent bidirectional signaling. This interaction triggers forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. Ephrin-B2/EFNB2 binds promiscuously to receptor tyrosine kinases such as EPHA4, EPHA3, and EPHB4. It cooperates with EPHB4 to regulate cell adhesion, migration, heart morphogenesis, and angiogenesis. Additionally, it participates in guiding the orientation of longitudinally projecting axons and interacts with PDZRN3 (By similarity).

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Ephrin B2 Protein at 2 μg/mL (100 μL/well) can bind Mouse EphB4 Protein. The ED50 for this effect is 10.87 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-hFc;C-6*His

Accession

P52800 (R29-E227)

Gene ID
Molecular Construction
N-term
EFNB2 (R29-E227)
Accession # P52800
hFc-6*His
C-term
Synonyms
rMuEphrin-B2/EFNB2, Fc-His; Ephrin-B2; ELF-2; EPH-related receptor tyrosine kinase ligand 5; HTK ligand; Elf2; Epl5; Eplg5; Htkl; Lerk5.
AA Sequence

RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSE

Molecular Weight

65-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His)
Cat. No.:
HY-P70378
Quantity:
MCE Japan Authorized Agent: