1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. Estrogen Receptor
  5. ER-beta
  6. ER beta/ESR2 Protein, Human (His)

ER beta/ESR2 Protein, a nuclear hormone receptor, binds estrogens akin to ESR1/ER-alpha. It activates estrogen-dependent reporter genes with ERE. However, it lacks ligand binding ability and exhibits minimal ERE binding, resulting in the loss of ligand-dependent transactivation ability. ER beta/ESR2 Protein, Human (His) is the recombinant human-derived ER beta/ESR2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ER beta/ESR2 Protein, Human (His) is 323 a.a., with molecular weight of 35-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ER beta/ESR2 Protein, a nuclear hormone receptor, binds estrogens akin to ESR1/ER-alpha. It activates estrogen-dependent reporter genes with ERE. However, it lacks ligand binding ability and exhibits minimal ERE binding, resulting in the loss of ligand-dependent transactivation ability. ER beta/ESR2 Protein, Human (His) is the recombinant human-derived ER beta/ESR2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ER beta/ESR2 Protein, Human (His) is 323 a.a., with molecular weight of 35-40 kDa.

Background

ER beta/ESR2, a nuclear hormone receptor, exhibits estrogen-binding capabilities comparable to those of ESR1/ER-alpha and, in turn, triggers the expression of reporter genes harboring estrogen response elements (ERE) in an estrogen-dependent fashion. However, it is noteworthy that ER beta/ESR2 lacks intrinsic ligand binding ability and displays either no or minimal ERE binding activity, resulting in the attenuation or loss of ligand-dependent transactivation capacity. This dual nature, where it can bind estrogens but lacks the typical ligand-dependent activation potential, underscores its distinct regulatory role and highlights its contribution to the intricate network of estrogen-mediated signaling pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q92731-3 (M1-A323)

Gene ID
Molecular Construction
N-term
6*His
ESR2 (M1-A323)
Accession # Q92731-3
C-term
Synonyms
Estrogen Receptor Beta; ER-Beta; Nuclear Receptor Subfamily 3 Group A Member 2; ESR2; ESTRB; NR3A2
AA Sequence

MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

Molecular Weight

35-40 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, pH 8.0 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ER beta/ESR2 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ER beta/ESR2 Protein, Human (His)
Cat. No.:
HY-P70791
Quantity:
MCE Japan Authorized Agent: