1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Erythropoietin/EPO Protein, Pig (His-B2M)

Erythropoietin (EPO) protein regulates erythrocyte proliferation and differentiation. EPO binds to its receptor (EPOR), inducing EPOR dimerization and activating JAK2. This triggers downstream effectors like STAT1 and STAT3, maintaining erythrocyte mass and homeostasis. Erythropoietin/EPO Protein, Pig (His-B2M) is the recombinant pig-derived Erythropoietin/EPO protein, expressed by E. coli , with N-6*His, B2M labeled tag. The total length of Erythropoietin/EPO Protein, Pig (His-B2M) is 168 a.a., with molecular weight of ~32.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Erythropoietin (EPO) protein regulates erythrocyte proliferation and differentiation. EPO binds to its receptor (EPOR), inducing EPOR dimerization and activating JAK2. This triggers downstream effectors like STAT1 and STAT3, maintaining erythrocyte mass and homeostasis. Erythropoietin/EPO Protein, Pig (His-B2M) is the recombinant pig-derived Erythropoietin/EPO protein, expressed by E. coli , with N-6*His, B2M labeled tag. The total length of Erythropoietin/EPO Protein, Pig (His-B2M) is 168 a.a., with molecular weight of ~32.6 kDa.

Background

Erythropoietin (EPO) protein is a crucial hormone that regulates the proliferation and differentiation of erythrocytes, ensuring a balanced and adequate level of circulating red blood cells. By binding to its receptor (EPOR), EPO induces EPOR dimerization and subsequently activates JAK2, initiating a cascade of events that involve specific downstream effectors such as STAT1 and STAT3. These molecular processes play a pivotal role in maintaining optimal erythrocyte mass and homeostasis within the body.

Species

Pig

Source

E. coli

Tag

N-6*His;B2M

Accession

P49157 (A27-R194)

Gene ID
Molecular Construction
N-term
6*His-B2M
EPO (A27-R194)
Accession # P49157
C-term
Synonyms
EPOErythropoietin
AA Sequence

APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR

Molecular Weight

Approximately 32.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Erythropoietin/EPO Protein, Pig (His-B2M) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Erythropoietin/EPO Protein, Pig (His-B2M)
Cat. No.:
HY-P72187
Quantity:
MCE Japan Authorized Agent: