Erythropoietin Protein, Cynomolgus (HEK293, His)

Erythropoietin Protein is a glycoprotein cytokine secreted mainly by the kidneys in response to cellular hypoxia. It regulates erythrocyte growth and balance. EPO binding to its receptor (EPOR) triggers EPOR dimerization, activating JAK2. This initiates downstream events involving effectors like STAT1 and STAT3, crucial for erythrocyte proliferation, differentiation, and maintaining optimal blood cell levels. Erythropoietin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Erythropoietin protein, expressed by HEK293 , with C-His, C-10*His labeled tag.

Erythropoietin (EPO) is a glycoprotein cytokine secreted mainly by the kidneys in response to cellular hypoxia. EPO plays a crucial role in regulating the growth and maturation of red blood cells, as well as maintaining the appropriate balance of circulating erythrocytes in the body. When EPO binds to its receptor (EPOR), it triggers EPOR dimerization, which in turn activates JAK2, initiating a cascade of events that involve specific downstream effectors such as STAT1 and STAT3. These molecular pathways are essential for ensuring the proper proliferation and differentiation of erythrocytes, as well as maintaining the optimal level of red blood cells in circulation. In addition, EPO has a range of actions beyond stimulation of erythropoiesis, including vasoconstriction-dependent hypertension, stimulating angiogenesis, and promoting cell survival via activation of EPO receptors resulting in anti-apoptotic effects on ischemic tissues^[1].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED₅₀ is typically 1-5 ng/mL.

Cynomolgus

HEK293

C-His;C-10*His

P07865/XP_005549312.1 (A28-R192)

101925524  [NCBI]

APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Approximately 19.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.