EXTL2 Protein, Mouse (HEK293, His)

The EXTL2 protein is a key glycosyltransferase in heparan sulfate biosynthesis, responsible for overseeing the conversion of β-1-4-linked glucuronic acid (GlcA) and α-1-4-linked N-acetylglucosamine (GlcNAc) units Alternating sulfate chains are added to the nascent heparan. The function of this enzyme is critical for the complex and precise construction of heparan sulfate, a key component of various biological processes. EXTL2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EXTL2 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of EXTL2 Protein, Mouse (HEK293, His) is 288 a.a., with molecular weight of ~35.0 kDa.

EXTL2 (Exostosin-Like 2) is a glycosyltransferase crucial for the biosynthesis of heparan sulfate, a complex and essential glycosaminoglycan. Its enzymatic activity involves the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains. This enzymatic process is integral to the construction of the intricate polysaccharide structure of heparan sulfate, which, in turn, plays key roles in various cellular functions, including cell signaling, adhesion, and tissue development.

Mouse

HEK293

N-6*His

Q9ES89 (N43-M330)

58193  [NCBI]

NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM

Approximately 35.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.