FABP1/L-FABP Protein, Human (N-His)

FABP1 Protein, Human (His) is a Recombinant FABP1 Protein with a His-flag. FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family.

FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family. FABP1 is a liver-specific FABP that plays important roles in intracellular lipid metabolism in the liver^[1].
FABP1 is expressed in renal proximal tubule cells and released into urine in response to hypoxia caused by decreased peritubular capillary blood flow^[2].

Human

E. coli

N-6*His

P07148 (M1-I127)

2168  [NCBI]

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

13-15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.5 M Argine, 50% Glycerol, 2 mM EDTA, pH 7.4 or 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. S H Chen, et al. Human liver fatty acid binding protein gene is located on chromosome 2. Somat Cell Mol Genet. 1986 May;12(3):303-6  [Content Brief]

  [2]. I-Ting Tsai, et al. FABP1 and FABP2 as markers of diabetic nephropathy. Int J Med Sci. 2020 Aug 27;17(15):2338-2345.  [Content Brief]

  [3]. Huifeng Pi, et al. Long-term exercise prevents hepatic steatosis: a novel role of FABP1 in regulation of autophagy-lysosomal machinery. FASEB J. 2019 Nov;33(11):11870-11883.  [Content Brief]