1. Recombinant Proteins
  2. Others
  3. FABP1/L-FABP Protein, Human (N-His)

FABP1/L-FABP Protein, Human (N-His)

Cat. No.: HY-P70264
SDS COA Handling Instructions

FABP1 Protein, Human (His) is a Recombinant FABP1 Protein with a His-flag. FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
500 μg Get quote
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FABP1 Protein, Human (His) is a Recombinant FABP1 Protein with a His-flag. FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family.

Background

FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family. FABP1 is a liver-specific FABP that plays important roles in intracellular lipid metabolism in the liver[1].
FABP1 is expressed in renal proximal tubule cells and released into urine in response to hypoxia caused by decreased peritubular capillary blood flow[2].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P07148 (M1-I127)

Gene ID
Molecular Construction
N-term
6*His
FABP1 (M1-I127)
Accession # P07148
C-term
Synonyms
rHuFatty acid-binding protein/FABP1, His; Fatty Acid-Binding Protein Liver; Fatty Acid-Binding Protein 1; Liver-Type Fatty Acid-Binding Protein; L-FABP; FABP1; FABPL
AA Sequence

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Molecular Weight

13-15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.5 M Argine, 50% Glycerol, 2 mM EDTA, pH 7.4 or 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FABP1/L-FABP Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP1/L-FABP Protein, Human (N-His)
Cat. No.:
HY-P70264
Quantity:
MCE Japan Authorized Agent: