1. Recombinant Proteins
  2. Others
  3. FABP2/I-FABP Protein, Human (His)

FABP2, also known as I-FABP, is involved in the intracellular transport of long-chain fatty acids and their acyl-CoA esters, reflecting its potential role in various metabolic processes. In particular, FABP2 is thought to be involved in triglyceride-rich lipoprotein synthesis, suggesting its importance in lipid metabolism. FABP2/I-FABP Protein, Human (His) is the recombinant human-derived FABP2/I-FABP protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of FABP2/I-FABP Protein, Human (His) is 132 a.a., with molecular weight of ~18 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FABP2, also known as I-FABP, is involved in the intracellular transport of long-chain fatty acids and their acyl-CoA esters, reflecting its potential role in various metabolic processes. In particular, FABP2 is thought to be involved in triglyceride-rich lipoprotein synthesis, suggesting its importance in lipid metabolism. FABP2/I-FABP Protein, Human (His) is the recombinant human-derived FABP2/I-FABP protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of FABP2/I-FABP Protein, Human (His) is 132 a.a., with molecular weight of ~18 kDa.

Background

The FABP2, also known as I-FABP (intestinal fatty acid-binding protein), is a member of the fatty acid-binding protein (FABP) family and is implicated in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 likely plays a role in triglyceride-rich lipoprotein synthesis. Notably, FABP2 exhibits a high affinity for saturated long-chain fatty acids, but its binding affinity is lower for unsaturated long-chain fatty acids. Additionally, FABP2 may contribute to the maintenance of energy homeostasis by functioning as a lipid sensor. These characteristics highlight the multifaceted role of FABP2 in cellular lipid metabolism, where it participates in fatty acid transport, influences lipoprotein synthesis, and potentially acts as a sensor to help regulate energy balance within cells.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

P12104 (M1-D132)

Gene ID
Molecular Construction
N-term
6*His
FABP2 (M1-D132)
Accession # P12104
6*His
C-term
Synonyms
rHuFatty acid-binding protein/FABP2, His; Fatty Acid-Binding Protein Intestinal; Fatty Acid-Binding Protein 2; Intestinal-Type Fatty Acid-Binding Protein; I-FABP; FABP2; FABPI
AA Sequence

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Molecular Weight

Approximately 18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 50 mM NaCl, 8% Trehalose, 0.05% Tween 80, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FABP2/I-FABP Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP2/I-FABP Protein, Human (His)
Cat. No.:
HY-P70284
Quantity:
MCE Japan Authorized Agent: