1. Recombinant Proteins
  2. Others
  3. FABP3 Protein, Mouse

FABP3 Protein, Mouse

Cat. No.: HY-P75218
SDS COA Handling Instructions

FABP3 is a member of the fatty acid-binding protein (FABP) family and is thought to facilitate the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As part of this family of proteins, FABP3 may play a crucial role in promoting cellular uptake and transport of fatty acids, supporting various metabolic processes within cells. FABP3 Protein, Mouse is the recombinant mouse-derived FABP3 protein, expressed by E. coli , with tag free. The total length of FABP3 Protein, Mouse is 133 a.a., with molecular weight of ~14.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FABP3 is a member of the fatty acid-binding protein (FABP) family and is thought to facilitate the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As part of this family of proteins, FABP3 may play a crucial role in promoting cellular uptake and transport of fatty acids, supporting various metabolic processes within cells. FABP3 Protein, Mouse is the recombinant mouse-derived FABP3 protein, expressed by E. coli , with tag free. The total length of FABP3 Protein, Mouse is 133 a.a., with molecular weight of ~14.8 kDa.

Background

The FABP3 protein, a member of the fatty acid-binding protein (FABP) family, is implicated in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As a representative of this protein family, FABP3 likely participates in facilitating the movement of fatty acids within cells, contributing to various cellular processes such as lipid metabolism, energy production, and cellular signaling. By binding and transporting long-chain fatty acids, FABP3 plays a crucial role in regulating the availability and utilization of these essential molecules within cells. The functional implications of FABP3's involvement in fatty acid transport underscore its significance in maintaining cellular homeostasis and metabolic balance, making it a key player in lipid-related processes.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P11404 (M1-A133)

Gene ID
Molecular Construction
N-term
FABP3 (M1-A133)
Accession # P11404
C-term
Synonyms
Fatty acid-binding protein, heart; H-FABP; MDGI; Fabp3
AA Sequence

MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA

Molecular Weight

Approximately 14.8 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FABP3 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP3 Protein, Mouse
Cat. No.:
HY-P75218
Quantity:
MCE Japan Authorized Agent: