1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily T Cell CD Proteins NK Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Superfamily Ligands FasL/CD178 FasL/CD178
  5. FasL/CD178
  6. Fas Ligand Protein, Human (P.pastoris, His)

Fas Ligand Protein, Human (P.pastoris, His)

Cat. No.: HY-P700521
Handling Instructions Technical Support

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals. Fas Ligand Protein, Human (P.pastoris, His) is the recombinant human-derived FASLG protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals. Fas Ligand Protein, Human (P.pastoris, His) is the recombinant human-derived FASLG protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

FASLG protein, a cytokine, specifically binds to TNFRSF6/FAS, serving as a crucial mediator of apoptotic signals within cells. It plays integral roles in various cellular processes, including cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis, and T-cell development. FASLG is actively involved in initiating fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells, contributing to the controlled termination of immune responses. Additionally, TNFRSF6/FAS-mediated apoptosis, facilitated by FASLG, plays a role in the induction of peripheral tolerance. Notably, FASLG binds to TNFRSF6B/DcR3, a decoy receptor that functions to block apoptosis. Furthermore, FASLG has the capacity to induce FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways, and, while it can induce apoptosis, its essentiality for this process remains to be confirmed.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P48023 (Q103-L281)

Gene ID

356  [NCBI]

Molecular Construction
N-term
6*His
Fas Ligand (Q103-L281)
Accession # P48023
C-term
Synonyms
Apoptosis antigen ligand ; APTLCD95 ligand ; CD95-LFas antigen ligand ; Fas ligand ; FasL; CD178
AA Sequence

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Weight

22.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Fas Ligand Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fas Ligand Protein, Human (P.pastoris, His)
Cat. No.:
HY-P700521
Quantity:
MCE Japan Authorized Agent: