Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His)

The FcγRIIIA/CD16a protein is a receptor for IgG and is optimally activated upon binding of aggregated antigen-IgG complexes, inducing antibody-dependent cellular cytotoxicity (ADCC). It mediates IgG effector function on natural killer cells, limiting viral load. Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-His labeled tag. The total length of Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His) is 192 a.a., with molecular weight of 33-40 kDa.

The FcγRIIIA/CD16a Protein functions as a receptor for the constant Fc fragment of immunoglobulin gamma (IgG), optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, leading to antibody-dependent cellular cytotoxicity (ADCC). It mediates IgG effector functions on natural killer (NK) cells, triggering cytokine production, degranulation, and limiting viral load during infection. Additionally, FcγRIIIA is involved in the generation of memory-like adaptive NK cells that efficiently eliminate virus-infected cells via ADCC and regulate NK cell survival and proliferation. As a Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, initiating intracellular signaling pathways such as phosphatidylinositol 3-kinase signaling and calcium flux, crucial for NK cell activation. FcγRIIIA also costimulates NK cells, triggering lysis of target cells independently of IgG binding. It plays a role in mediating the antitumor activities of therapeutic antibodies and, upon ligation on monocytes, induces tumor necrosis factor-alpha (TNFA)-dependent ADCC of IgG-coated tumor cells. Furthermore, FcγRIIIA interacts with CD2, contributing to NK cell activation and cytotoxicity, and interacts with S100A4, inhibiting PKC-dependent phosphorylation of FCGR3A.

1. Measured by its binding ability in a SPR assay (Biacore T200). Rituximab captured on CM5 Chip via Protein A can bind Cynomolgus Fc gamma RIII with an affinity constant of 0.251 μM.
2. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED₅₀ for this effect is 0.276 μg/mL, corresponding to a specific activity is 3.62×10^3 Unit/mg.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED₅₀ for this effect is 0.276 μg/mL, corresponding to a specific activity is 3.62×10³ Unit/mg.

Cynomolgus

HEK293

C-His

Q8SPW2 (G17-Q208)

102140945  [NCBI]

GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ

33-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.